SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000598927 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000598927
Domain Number 1 Region: 88-261,386-438
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.13e-45
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0000583
Further Details:      
 
Domain Number 2 Region: 264-388
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1.79e-36
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0000323
Further Details:      
 
Domain Number 3 Region: 479-578
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 3.92e-24
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000598927
Sequence length 601
Sequence
MATCIPAGSGRLHCRVRDXKGQGCRRTCWIASVAFSGCIQKDFSWSHGVSKFLQIQRCNF
SPSPINENSKTLRTVTSSSLRDDSTKFFDFAVIGSGVAGLRYALEVAKHGSVAVITKAEP
HESNTNYAQGGVSAVLSLSDSVESHVQDTIVAGAYLCDEETVRVVCTEGPERIRELIAMG
ASFDHGEDGNLHLAREGGHSHHRIVHAADMTGREIERALLEAVLKDPKIFMFEHHLAIDL
LTCQVATGDGIAMAHRAQAVISNMEFVQFHPTALADEGLPVXPTKARENAFLIXEAVRGD
GGILYNLDMERFMPLYDERAELAPRDVVARCIDDQLKKRNEKYVLLDISHKPREKILSHF
PNIAAECLKYXLDITXQPIPVVPAAHYMCGGVRAGLQGETNVQGLXVAGEVACTGLHGAN
RLASNSLLEALVFARRAVXPSIXHMKCSSLDFSTSDWWARPAVPVSLESNAIEKXLAMTR
EVRKEVQSIMWKYVGIVRSTTRLETAKQKICVLEDKWEDYLFQMGWEPTMVGLEACEMRN
FFCCAKLVVSSALARHESRGLHYTIDFPDLEESKRLPTVILPSSSVRXSWSSRQLHKLPL
C
Download sequence
Identical sequences MDP0000598927|PACid:22655979 MDP0000598927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]