SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000609131 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000609131
Domain Number 1 Region: 36-342
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.8e-24
Family FAD-linked reductases, N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000609131
Sequence length 414
Sequence
MSSXSTPTATFIFSLLPLFLLLLSDANANAVDSASTVCIIGSGIGGSSVAHFLRRYSPPH
LNFTIRIFERNPVVGGRMATVNVSGHIFEAGASILHPRNLHAVNYTKLLNLAVNSPSSSD
ESSSSAFGIWDGHQFVFKTLSFKSELPFVDKIVSLANSLLMLFRYGYSLIRMDKFVETAV
NKFCKYYESFETRPXFETVDEMLKWAGLYNLTTATLAVELADAGLSPLLIQELVTVITRI
NYGQSVSMSGLAGAVSLAGSGGGLWAIKGGNWQMAAGLIDXSDVELHLQEEIESISSNGE
YYELNSTLRNSYTCDIAVVASPLDELSLKFNPPISIPKRELQHTHATFVRGLLNPVYFGL
NSVAEIPELVGTIEIPDLPFSSISVLKQHDEKDFTYKIFSRKPMADAILDSIFR
Download sequence
Identical sequences XP_008337150.1.92800 MDP0000609131|PACid:22633588 MDP0000609131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]