SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000611628 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000611628
Domain Number 1 Region: 42-147
Classification Level Classification E-value
Superfamily Phospholipase C/P1 nuclease 6.05e-24
Family P1 nuclease 0.013
Further Details:      
 
Domain Number 2 Region: 489-673
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.28e-18
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0088
Further Details:      
 
Domain Number 3 Region: 319-531
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.29e-17
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000611628
Sequence length 760
Sequence
MATCQLXAYGRIRSGIGTDTGGLAXFTSSTHQIMLAPLTTQVWDWEIIQQAMKDYYDKDM
ELLLQDILANITDGIWSDDVTSWKHCDDQRSCINKYATESINIACKWAYKGVEAGDTLTE
DYFLPRLPVVEKRIAQGGVRLAAILNRVFSSSQDTGVDDDTCKEDRERIHIRGKWFMKVG
PTEQNDTTMRXKEYLPLLLRGEVLNLNMAFERISRTARHGFRRSPSGASSRTTEKDMLCE
RASTXKYCSVPSLEREXRNNNLSYLSSISKVNHNSFWSRGISITPXYQFPSAERIVEESD
SECNDPKYPGLEATRPSEKPRVVVLGTGWAACRFLKGLDTKVYDVVCISPRNHMVFTPLL
ASTCVGTLEFRSVAEPVSRIQSALAXSPSSYFYMASCXGLDTDKHEVYCXTISNGGLSHE
PYRFKVAYDKLXIAAGAEPLTFGIKGVKEHAFFLREVNHAQEIRKKLLLNLMLSEHPGIS
EEERKRVLHCVVIGGGPTGVEFSGELSDFIMKDVQERFSHVKDYIKVTLIEAIRNKSLDQ
GKFGLPSNTXXYFLLILGMDLKCGPFHQVGVRLMRGVVKEVHPKKIVLNDGTDVPYGLLV
WSTGVGPSEFVKKLXLPKSPGGRIGVDGWMRVPSVEDVFALGDCAGFLEETGRPVLPALA
QVAEREGKYLVEXFNRIGKQDAGKAFSAKDIPLGEQFVYKHLGSMATVGGYKALVDLRQS
KPFVARKELKKPLPFPVTHSSKKYNSSTKNLDWLIDHHMI
Download sequence
Identical sequences MDP0000611628|PACid:22643604 MDP0000611628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]