SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000634676 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000634676
Domain Number 1 Region: 52-225,319-429
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.55e-43
Family FAD-linked reductases, N-terminal domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000634676
Sequence length 1158
Sequence
MVYEYVLAGVLVSLLSSVFFLIINTTYSEKKKEDVANVSETGVFLETEIEKNTDVVIVGA
GVAGAALAYTLGKEGRRVHVIERDLNEPDRIVGELLQPGGYLKLIELGLEDCANESIDAQ
KVFGYALYKNGNDTKLSYPLETYSSDIAGRSFHNGRFIQRMRERAATLSNVKMEQGTVTT
LIEENGXIRGVMYKNKAGEEMRTYAPLTIVCDGCFSNLRRSISTPNIENPSCFVGLILEN
CELPHANHGHVILGDPSPILFYPISSTEVRCLVDVPGTKVPSVANGEMAQYLKTVVAPQV
PHQLLKAFLAAVDKGIIRTMQNKSMPAAPQPTPGAILLGDAFNMRHPLTGGGMTVALSDI
VLLRDLLRPLSDFNDAPALCDYLESFYTLRKPVSSTINTLAGALYKVFCASPDLARQEMR
EACFDYLSLGGICSNGPISLLSGLNPXPXSLFLHFFAVAVYGVGRLMIPFPTPKRMWLGA
RLIVSASGIIFPIIKAEGVRQMFFPATMPAYYRAPPVHRRIETRTKLKCGKQGQSISVQA
TTLSQAHEQHSLPNVQDNNASGGVVTNLASARPXVSISPHVALPXNASENSNLQSVFGNS
QRSVGNLSGCGQPFNISVNNLRQEQGRQNSPQIVSQQNHEQLNPHLYKXVKQENISPSYI
TQKQLQXQHHYQPKLLNPTQQHTSQXSMLQTPVMCPSETRVAQLSDIWXDQMSYFDQTTQ
SGNKTQSQIAFRQTNQSQVALDIHQNVSSSSQNPLMQSQKQVHLIGRKLTATNTQQSHLD
GQPNGCPNLHQQQPRLPCQQNTVQQQFQVQKINHSSAHHEQLSERNNMYVLPQSSQLLET
ECASSGMRLCEVKMQGQTQHKASVLLPNQDQESQADSLERRLNSQIQPQKMEQLPDPSAQ
DQQQTYQTSGKTVEPNHIYSQLTCTPSFYTRLTGTLTSSSARRVSCTENWQEDAYQMLQS
LKSKYLTPLTDMYNTITCRLQQHSGMVRLQSGASFPTALPKTYGSSCSQVPRCPTIDKKN
LPMPLTEARTTFYPINSXSTKTSCSVPLPSSSVPGDLERPISDTSSLSNAGDEQVNIAAK
SPSPIAISTPGISVSPLLEESSNVIHCDTSTTMSDELXASEQPIQRLIKVVRYINMPPYS
NVRCTSATMLHKFYMKDA
Download sequence
Identical sequences MDP0000634676 MDP0000634676|PACid:22625957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]