SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000656178 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000656178
Domain Number 1 Region: 75-425
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.11e-51
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0013
Further Details:      
 
Domain Number 2 Region: 434-548
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 5.5e-35
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000656178
Sequence length 566
Sequence
MQASLSLLSPAVPRPSYVVQSALPLPPSKPINLRFCGLRREALGFSPLGRSDSHRVRLSA
PSRSSTISASSSSGNGSPPKSFDYDLLIIGAGVGGHGAALHAVEKGLKTAIVEGDVVGGT
CVNRGCVPSKALLAVSGRMRELQNEHHLKALGLQVSAAGYDRQGVADHANNLATKIRNSL
TNSMNSLGVDILTGVGTILGPQKVQIGSSDKVVTAKDIIIATGSVPFVPKGIEVDGKTVI
TSDHALKLEFVPEWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKLAQ
RVLINPRKIDYQTGVFASKITPAKDGKPVTIELIDAKTKEPKETLEVDAALIATGRAPFT
QGLGLENVDVATQRGFIPVDERMRVIDANGKLVPHLFCIGDANGKMMLAHAASAQGISVV
EQVTGRDHVLNHLSIPAACFTHPEISMVGLTEPQAREKAEXEGFEVSIAKTSFKANTKAL
AENEGEGLAKLIYRPDNGEILGVHIFGLHAADLIHEASNAIALGTRIQDIKFAVHAHPTL
SEVLDELFKSAKVAHVPSPVSEPVAV
Download sequence
Identical sequences MDP0000656178|PACid:22657871 MDP0000656178 XP_008390549.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]