SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000671114 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000671114
Domain Number 1 Region: 9-95
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000278
Family Thi4-like 0.0000872
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000671114
Sequence length 250
Sequence
MSANGLNLSYDLSAFKFDPIKESIVSREMTRXYMTDMITYADTGIIVVGXGSAXLSCTYE
LSKKPDVQVAITEQSVSXGGGAXLGGQLFSAMDSDPKPHTTYGRPXRKXGQSTRTQNRIF
IENIYENXRKSTYEVYDQEERRRKRVQRASDDEENRSTRKELGRRSDWGWRGVGAAKRRN
DXRLGNIIDXCGHHCVCPVVVVRFPXDDNCGIADGGFGAPXVAAAVVXVKENEEEEAXIK
XVLKEXQQNN
Download sequence
Identical sequences MDP0000671114 MDP0000671114|PACid:22638724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]