SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000683043 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000683043
Domain Number 1 Region: 13-50
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000463
Family G proteins 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000683043
Sequence length 65
Sequence
MFLLVFFYEVLALLGLWQEAKILFLGLDNAGKTTLLHRLKDEVVSEHIRPHTPLRDAFIP
APIYD
Download sequence
Identical sequences MDP0000683043|PACid:22681712 MDP0000683043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]