SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000686821 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000686821
Domain Number 1 Region: 3-206
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.53e-39
Family FAD/NAD-linked reductases, N-terminal and central domains 0.066
Further Details:      
 
Domain Number 2 Region: 171-209,261-367
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000366
Family FAD/NAD-linked reductases, N-terminal and central domains 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000686821
Sequence length 385
Sequence
MEEVQVVIVGAGPAGLATSACLNHLNITNAVLEREDCYASLWKKKSYDRLKLHLAKQFCE
LPYMPFPSDTPTYVPKNLFVQYLDTYVSHFNINPKCNRSVKSAXYDVDLEKWYVKVENTL
SGAQEMYLGKFLVVASGENSVGYIPQVRGLDGFNGQAIHSSKYENGKKYGGKNVLVVGSG
NSGMEIAYDLSNSGANTSIVVRSPVHVLSKEIVFFGMVLLKLLPVTIVDKVVVGLGKLKY
GNLSKYGIQKPKQGPFYLKATKGRSPTIDVGCIKKIKTREITVLPSITSIEGNLIRFENG
IYNWYDAIIFATGYKSSVLNWLKDDNCYFNDNGMPRKRFPDHWKSENGLYSAGFSSRGLL
GIAHDAHCIANDISSSLNLHYKKMX
Download sequence
Identical sequences MDP0000686821|PACid:22637777 MDP0000686821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]