SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000686885 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000686885
Domain Number 1 Region: 8-225,329-390
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.12e-41
Family FAD-linked reductases, N-terminal domain 0.0000806
Further Details:      
 
Domain Number 2 Region: 227-329
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000000000000341
Family D-aminoacid oxidase-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000686885
Sequence length 401
Sequence
MEYSGDEFDVIVVGAGVMGSSTAYQTAKRGHKTLLLEQFDFLHHRGSSHGESRTIRATYP
EDYYTPLVLESYKLWQQAESEIGYNVYFKANQLDMAPANDKVLLAVVDSCRKNSVAFSVM
NRDQLHQEFSGRVMIPEDWVGVVTEHGGVIKPTKAVSMFQTLALQNGAVLRDNMEVKGVE
RDGVRGGVWVSTAKGKRFWGKXCVVTVGAWTTKLVKTVGGIELPIQPLETTVCYWRIKEG
HEGAFAIGGDFPTFASYGNPYIYGTPSLEYPGLIKVAVNGGYPCDPDKRPWGPGNPLAPL
KEWIEGTFSGVVDSGGPVATQLCMYSITPDEDFVIDFLGGEFGKDVVVGGGFSGHGFKMS
PVVGRILADLALTGEAEGVELKQFRIARFQENPKGNAKDFL
Download sequence
Identical sequences MDP0000686885|PACid:22670382 MDP0000686885 XP_008347646.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]