SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000711403 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000711403
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000046
Family Protein kinases, catalytic subunit 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000711403
Sequence length 163
Sequence
MIARVGDFGLARLISATVDSSLNQSSTVGIMGTIGYATPGYEIGGEPSRQGDIYSYGILV
LEMFTGRRPTEEMFKDGFNLHNFVKMAIPERTMQIVXPALLAAIEEKAPAAKGKEANXXN
GETESGEENKNYVNISEMNPFVRKCILPVLEIGLACSEESPKT
Download sequence
Identical sequences MDP0000711403|PACid:22663870 MDP0000711403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]