SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000713248 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000713248
Domain Number 1 Region: 14-125
Classification Level Classification E-value
Superfamily TPR-like 2.25e-17
Family Tetratricopeptide repeat (TPR) 0.0000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000713248
Sequence length 193
Sequence
MDLQHNDFDRILFFEHARKISEATYIKNPLDADNLTRWAGALLELSQFQNVLESKKMTQD
AISKLEEALKINPRKHDALWCLGNAQTARGFFTPDQKEARVYFQKASQCFQKALDEAPQL
HLDLHKHGLGQLGMEAAAGAGTGPSTSIGGKTTKKNKNSDLKYDIFGWIILGVGIFAWLR
YAKSHMPPPPLPQ
Download sequence
Identical sequences MDP0000713248 MDP0000713248|PACid:22631123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]