SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000727481 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000727481
Domain Number 1 Region: 29-87,117-230
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.44e-34
Family GMC oxidoreductases 0.00064
Further Details:      
 
Domain Number 2 Region: 1-26,229-284
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000185
Family FAD-linked reductases, N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000727481
Sequence length 291
Sequence
MLSGVGPAEQLKAHNITVVVDQPMVGQGMSDNPMNAIFVPSPIPVEVSLIQVVGITHFGS
YIEAASGENFAGGSTTKDFGMFSPKIGQLSTVPPKQRTPEALAEAVRYMDSLEDAAFXGG
FILEKVMGPISTGHMELRTRNPNDNPAVTFNYFKEPQDLERCVQGIETIEKIXESKAFSK
FRYEGMSIAALLNATASSPVNLLPKHANASRSLDQFCKDXVMTIWHYHGGCQVGRVVDHD
YKVLGVDALRVIDGSTFNYSPGTNPQATVMMLGRYMGKTILDERLASDVSN
Download sequence
Identical sequences MDP0000727481 MDP0000727481|PACid:22682921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]