SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000738522 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000738522
Domain Number 1 Region: 44-199
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000722
Family FAD-linked reductases, N-terminal domain 0.00000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000738522
Sequence length 206
Sequence
MSAISSVLLLLVLYLQSEVHSLATPSDHGESLPTSYPNVLTQDGFAYNLQQEDDGTTPVQ
RIMSEDGIPTVRGRLLGGTSMINAGVYARANMSFYNQSGIEWDMELVNNTYEWVEDTIVY
KPNSFPWQSVIREAFLEAGGYDPDNGFSLDHIKGTRVTGSTFDNYGTRHGADELLNKGNP
NNLRVAVHATVEKIIFSSNESGMLHL
Download sequence
Identical sequences MDP0000738522|PACid:22680891 MDP0000738522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]