SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000741065 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000741065
Domain Number 1 Region: 57-166
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.59e-23
Family G proteins 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000741065
Sequence length 181
Sequence
MEGNRKQTKLGSKTTTSSSSSTTTTFKDEGSSAALVVGAEHAVPLSVVEDAPIVSSYNDK
IRPLLDAVDKLRNLMVMEEGIQLPTIVVVGDQSSGKSSVLESLAGISLPRGHGICTRVPL
VMRLQHHSSREPELSLQYNXRVEHTDEDNISEDIVNATNLIAGEGYFRYPIDFACEKEGR
A
Download sequence
Identical sequences MDP0000741065|PACid:22630463 MDP0000741065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]