SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000745172 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000745172
Domain Number 1 Region: 25-121
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.97e-17
Family Tyrosine-dependent oxidoreductases 0.0033
Further Details:      
 
Domain Number 2 Region: 232-317
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000547
Family Thi4-like 0.0000894
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000745172
Sequence length 352
Sequence
MCKEGRLTLRFEDVTTGQRFRAKGHNDFYSATKAQGEELVIKANGVKGLLTCCIRPSSIF
GPGDRLLVPSLIVNARTWKSKFIIGDGNNIYDFTYVENVAHAHICAERALASEGKVADKA
AGQEGLKRTIEAYPHLRAEHRPKREGPSKASIYLGSGRGYKIEKLQSSHFRLSEETSQQI
AKSLASSWNASVKTLISLAKGYDGILFLKPAKAAPASNGGLSVSTSANGLNSSYDLSAFK
FDPIKESIVSREMTRHYMTDMITYADTGIVLVGAGSAGLSCAYELSKNPDVQVAITEQSV
SLGGGAWLSGHLLSAMDSDPKPHTTSRRPARKSGQSTQNPKALIIFRKRRKQ
Download sequence
Identical sequences MDP0000745172|PACid:22667211 MDP0000745172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]