SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000755938 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000755938
Domain Number 1 Region: 38-212
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000168
Family FAD/NAD-linked reductases, N-terminal and central domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000755938
Sequence length 216
Sequence
MPLEKYGLKPDHSFEEDYASCQMAIMPENFFSEADKGKIVFKRSTSKWWFSADGIEFDDN
TKIKADVVVLATGYDGKKKLKFILPDPFRSLLEYPSGIIPLYRGTIHPLIPNMAFVGYLE
SVSNLHSSELRSIWLARLLDNKFKLPSVQKMLEQTSKEVEISKKTTRFYRRHCISTFSIN
HSDEICEEMGWTSWRKNTWLAEAFSPYGSQDYLNKH
Download sequence
Identical sequences MDP0000755938 MDP0000755938|PACid:22650525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]