SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000770761 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000770761
Domain Number 1 Region: 1-55
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000634
Family FAD-linked reductases, N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000770761
Sequence length 79
Sequence
MLSGVGPAFHFRAHGIXVIADCPMVGQGMADNPMNILLIPSPQPVEVSLVQVVGIKQFGS
YIEGASGLTLSIPSAHRPL
Download sequence
Identical sequences MDP0000770761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]