SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000790657 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000790657
Domain Number 1 Region: 2-65,172-231
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000163
Family FAD-linked reductases, N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000790657
Sequence length 321
Sequence
MRERAATLPNVKLEQGTVTTLLEEKSTIKGVMYKNKTGXEMRTYAPLTIVCDGCFSNLRC
SISTPNENNRRTNFVLILQIENLSCFVGLILENCELPHANHGHVILGDPSPILFYPISST
EVRCLVDVPGTKVPSVANGEMAQYLKTIVAPQVPRQLLRAFLATVDKGIIRTMQNKSMLA
APRPTPGAILLGDAFNMRHPLTGGGMTVALSDIVLLMDLLRPLTDFNDAPLLSSVIYHKH
ISWCPLQGVLASPDLARQEMREACFDYLSLGGVCSNGPISLLSRLNPRPIMPVSLILCCG
CLWSRPLNDSIPYTKKLVVGG
Download sequence
Identical sequences MDP0000790657 MDP0000790657|PACid:22654829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]