SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000795437 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000795437
Domain Number 1 Region: 13-120
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000285
Family FAD/NAD-linked reductases, N-terminal and central domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000795437
Sequence length 123
Sequence
MAHYASISIRECIHGRIPQLAVIGFSESLSNLYTSEMRCRWVAELLGRTFTLPSIKEMEK
DVNEWDGFAKRYAGKYYRRSCNGTVHIWYNDQLCKDMEWNPKRKKGLFAELFEPYGPLDY
APS
Download sequence
Identical sequences MDP0000795437 MDP0000795437|PACid:22664825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]