SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000854208 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000854208
Domain Number 1 Region: 55-312,404-462
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.11e-63
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0000156
Further Details:      
 
Domain Number 2 Region: 277-401
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 9.87e-37
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0000287
Further Details:      
 
Domain Number 3 Region: 492-591
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 6.15e-24
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000854208
Sequence length 614
Sequence
MPCLHIFPQFSRSHGVSKFLQIQRCNFSQSPITENSKTLRTITSSSLRDGSTKFFDFAVI
GSGVAGLRYALEVAKHGSVAVITKAEPHESNTNYAQGGVSAVLSQSDSVESHMQDTIVAG
AYLCDEETVRVVCTEGPERIRELIAMGASFDHGEDGNLHLAREGGHSHRRIVHAADMTGR
EIERALLKAALKDPNIFMFEHHLAIDLLTCQDGSDTVCLGVDTLNTETQEVIRFISKVTL
LASGGAGQIYPTTTNPPVATGDGIAMAHRAQAVISNMEFVQFHPTALADEGLPIQPSKAR
ENAFLITEAVRGDGAILYNLDMERFMPLYDERAELAPRDVVARGIDDQLKKRNEKYVLLD
ISHKPREKILSHFPNIAAECLKYXLDITCQPIPVVPAAHYMCGGVRAGLQGETNVQGLYV
AGEVACTGLHGANRLASNSLLEALVFARRAVQPSIKHMKCSSLDFSASDWWARPVVPVSL
ESNAIEKILSMTREVRKEVQSIMWKYVGIVRSTTRLETAKQKICDLEDKWEDYLFQMGWE
PTMVGLETCEMRNFFCCAKLVVSSALARHESRGLHYTIDFPDLEESKRLPTVIFPCASXR
SSWSSRQLQKLPLC
Download sequence
Identical sequences MDP0000854208|PACid:22682207 MDP0000854208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]