SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000857446 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000857446
Domain Number 1 Region: 52-224,318-428
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.2e-44
Family Thi4-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000857446
Sequence length 528
Sequence
MVYEYVLAGVLVSLLGSVFFVIINNTLSENKRDVAIVSENGVCLAPEIEKSTDVVIVGAG
VAGAALAYTLGKEGRRVHVIERDLSEPDRIVGELLQPGGYLKLIELGLEDCANESIDAQK
VFGYALYKNGNDTKLSYPLETYSSDIAGRSFHNGRFIQRMRERAATLSNVKLEQGTVTTL
IEEKGTIKGVMYKNKAGEEMRTYAPLTIVCDGCFSNLRRSISTPNIENPSCFVGLILENC
ELPHANHGHVILGDPSPILFYPISSTEVRCLVDVPGTKVPSVANGEMAHYLKTVVAPQVP
HQLLKAFLAAVDKGIIRTMQNKSMPAAPQPTPGAILLGDAFNMRHPLTGGGMTVALSDIV
LLRDLLRPLSDFNDAPALCDYLESFYTLRKPVSSTINTLAGALYKVFCASPDPARQEMRE
ACFDYLSLGGICSNGPISLLSGLKPCPIILFLHFFAVAIYGVGRLMFPFPTPKRMWLGAR
LILSASGIIFPIIKAEGVRQMFFPTTMPAYYKVPPVHRRIKTSTKHVF
Download sequence
Identical sequences MDP0000857446 XP_008356793.1.92800 MDP0000857446|PACid:22649571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]