SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000869086 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000869086
Domain Number 1 Region: 8-234
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.38e-47
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0041
Further Details:      
 
Domain Number 2 Region: 267-438
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.21e-16
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000869086
Sequence length 461
Sequence
MVSETYRSKNVCVIGAGPSGLVAARELRKEGHKVVVLEQNHDVGGQWLYDPNVEGEDPLG
RVPTLKVHSSLYTSLRLISPREIMGFTDFPFAVKKGRDMRRFPGHRELLLYLKDFCDWFG
LRELIRFNTRVSYVGMLDGDHVVGCKDLKWVVKSVEKKTEIFIEEVFDAVVVATGHYSKP
RLPSIQGMDAWKRKQLHSHIYRVPEPFRDEVVVVVGTSLSGQDISMELVDVAKAIYLSGK
SLDISEGLSKVISKHENLHLRPQIEALQEDGKVLFVDGSWVIADTIMYCTGYSYTFPFLD
TKGIVTVDDDRVSPLYEHTFPPSLAPSLSFIGIPRKIIGFPFFESQAKWIAQLLSGKTTL
PSRDDMMQSIKEFYHSRDVAGIPKHNTHDIAEFEYCDKYGDHIGFPHLEEWRKELCLSAL
RNAETDLETYRDSWDDHELLQEALQSPHFTQLGAQDLDFPL
Download sequence
Identical sequences MDP0000869086|PACid:22644121 MDP0000869086 XP_008374590.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]