SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000873258 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000873258
Domain Number 1 Region: 6-64
Classification Level Classification E-value
Superfamily DNA-binding domain 1.7e-20
Family GCC-box binding domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000873258
Sequence length 203
Sequence
MVQSKKFRGVRQRHWGSWVSEIRHPLLKRRVWLGTFETAEEAARAYDEAAILMSGRNAKT
NFPVFTNEMAAANDLNNNSSNSNNNSSTSSTTLSAILSAKLRKCCKSPSPSLTCLRLDTE
NSLIGVWQKGAGPRSDSNWLMMVELDQKSRLQAPQSEISSSTSCALDTEGMAGGQEGGDV
DNRMMDEEERVALQMIEELLNRN
Download sequence
Identical sequences MDP0000873258|PACid:22623173 MDP0000873258 XP_008373952.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]