SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000879254 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000879254
Domain Number 1 Region: 26-171
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.79e-29
Family Extended AAA-ATPase domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000879254
Sequence length 200
Sequence
MVYFQAGSRTIDIELTTLSSTNHIELNPSDAGFQDRYIVQEIIKEMAKNRPIDTKGKKGY
KVLVLNEVDKLSREAQHSLRRTMEKYSAYCRLILCCNSSSRVTEAIRSRCLNVRINSPTE
DQIVKVLEFIGKKEGLQLPSGFVARIAEKSNRSLRRAILSLETCRVQELSAIVLIDHQLX
QAVLFLVXXASCSNCTVPDT
Download sequence
Identical sequences MDP0000879254 MDP0000879254|PACid:22623848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]