SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000897124 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000897124
Domain Number 1 Region: 47-365
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.24e-67
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000111
Further Details:      
 
Domain Number 2 Region: 386-508
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 4.3e-43
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000493
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000897124
Sequence length 509
Sequence
MAMASLARRKAYLLSRNLSNTSSEAVRYSSLTSFSRGFASSGSDENDVVVVGGGPGGYVA
AIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMFHEAKHAFSHHGVKFSNVE
IDLPAMMSQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFISPSEISVDAIDGENTVVKGK
NIIIATGSDVKSLPGITIDEKKIVSSTGALALQEIPKKLVVVGAGYIGLEMGSVWGRLGS
EVTVVEFGPDIVPSMDSEIRKQFQRSLEKQGMKFMLKTKVVGVDTSGDGVKLTLEPASGG
DQTSFEADVVLVSAGRVPFTSGLDLDKIGVEMDKGGRILVNERFSTNVSGVYAIGDVIPG
PMLAHKAEEDGVACVEFLAGKVGHVDYDKVPGVVYTHPEVASVGKTEEQVKASGVAYRVG
KFPFMANSRAKAIDNAEGLVKILAEKETDKILGVHIMASNAGELIHEAAIALQYDASSED
IARVCHAHPTMSEALKEAAMATYDKPIHI
Download sequence
Identical sequences MDP0000897124|PACid:22647159 XP_008368565.1.92800 MDP0000897124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]