SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000902209 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000902209
Domain Number 1 Region: 31-289
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.44e-18
Family Thi4-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000902209
Sequence length 293
Sequence
MASSSSCSVGSPSSLTQLHRPPPSLSPSCVRYAVLGAGFAGLSVAWHLLKQSPKDSNIRV
DIYDEAGIGGGASGVSGGLLHPYSPKAKLLWRAADCWSESLNLLSAAEAAVASAAQTSDG
PTPIVRRRGILRPALSLKNLVLLKDNAQSCLASCRIETLDNDAAQNLVPGISPPLDASFY
MPEAVNIHPQRYLQALFLACQNLVKELRASGTGVKELHLHKSSVHKLVDLEDSMFQIGCL
TFHAASVISEGEYQAVIVCLGAKADMLPELCGRLPLRTCRGVVAHLQLPDDIG
Download sequence
Identical sequences MDP0000902209|PACid:22678199 MDP0000902209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]