SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000919706 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000919706
Domain Number 1 Region: 46-85
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000348
Family FAD-linked reductases, N-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000919706
Sequence length 87
Sequence
MEKSTTAAILLLLYFFGFFPQPEVHSFANPSDDLGKYSLKVPLVFQNFGYLKFVRNATDL
PLQEEYDYIVVGGGTAGCPLAATLSAN
Download sequence
Identical sequences MDP0000919706 MDP0000919706|PACid:22656631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]