SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000941459 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000941459
Domain Number 1 Region: 1-360,497-553
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.42e-48
Family FAD-linked reductases, N-terminal domain 0.0027
Further Details:      
 
Domain Number 2 Region: 345-486
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.7e-16
Family L-aminoacid/polyamine oxidase 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000941459
Sequence length 562
Sequence
MVAKKSRIVIIGAGMAGVTAANKLYTAAGSKDLFELVVVEGGERIGGRINTSEFGGDRIE
MGATWIHGIGGSPVHKIAQEINALEXAHPWECMDGSSDEPTTVAXXXLELEPDVVDPISS
LFKNLMDYAQGKQVFDESPERECNGDFEYSKLGDXASRICASNDDVGKLSVGSFXRQGLD
TYWVSKKNRDEQVSXYTNWSXXLLQEAIFAMHENIQRTYTSAGDLLTLDYNAESEYRMFP
GEEIXIAKGYLSIVQSLASVLPPGLIQLGKKVRKIQWQPDNRKNKGYESDTRPVKLHFSD
GSVLLADHVIVTVSLGVLKASIRQDSGMFNPPLPRFKTEAISRLGFGVVNKLFLQLGSIH
APPKSQDFSKFPFLQMVFHRADSELRNKKIPWWMRKTASLCPLYHDSSVLLSWFAGEEAR
ALEALSDEEIINGVSQTVSSFLSQNSHSHELCNGNGNPEENSEVKFSKVLKSQWGSDPLF
LGSYSYVAVGSSGEDLDSMAEPLPSDDSGSAASSSPPLQILFAGEATHRTHYSTTHGAYC
SGLREANRLLQHYQLVGVQKNY
Download sequence
Identical sequences MDP0000941459|PACid:22654340 MDP0000941459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]