SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000946880 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000946880
Domain Number - Region: 131-164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000954
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 196-273
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00294
Family Anti-platelet protein 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000946880
Sequence length 293
Sequence
MTFVTLGCRLTRVYLGIRGISVGENQYVISKSESIPYWKGGERATDTFDSFDQMLPAVTY
LLSNFSNKCVVRNYPKIFSSPSKNSTIKNIEIPPRSEYNYTRLVISITGEIQFLTWIDYT
KQWNLYWSAPRDNCSVFNACGNFGSCNDNNMPFLCKCLPGFKPQYLQQWNSGDFSGGCTR
KSLLRGDNKNDTFLSLKKMKVGNPDSEINVDNETECRNVCLNSCRCMAYSHTISETNSHR
MEAHAPTSLCRIWNVGDLNNLEEEYTNTGQDLYVRVALSDLGILPLKFSETIK
Download sequence
Identical sequences MDP0000946880|PACid:22625849 MDP0000946880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]