SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000137471 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000137471
Domain Number 1 Region: 438-742
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.44e-78
Family Protein kinases, catalytic subunit 0.0000849
Further Details:      
 
Domain Number 2 Region: 90-188
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000824
Family alpha-D-mannose-specific plant lectins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000137471
Sequence length 770
Sequence
MRLNVVLILKIFSCFCXQSFLSSSHAQTLDFPVLLKQGQRLADRDRNYLVSENGGLFKLG
FLSPGTSSASGATSXRYLGMFYTSLPSHPDAVWLANPKTPISDSSGVFTLDSDGKLKIVY
SGGEISVSDSNQTVSGMNFKTGQNWTLFSWLSDQVPEPGAFKLGXDPGAAXQLVIWRRGD
VYWTSGVWXNGSFXGSPELTRRVDLFEFTFVSSKEEKWELSLQGQISQSXLAPNKTTWES
TVTGPCKLNMNYPDAMCIEEKITECRNXSELFVPIRGYFAAVKFLYXDDDTSLAISDCHA
XCWRNCTCIGYESLYTXNGTGCVYMMEGAKFEEXDYXGFTYILTIXXNSSKDGTPTEEGK
KIGSAGSVAKKWWIWFIISITLSVTVLLLGYLCYIRKIKRRFMQHTGXEQGLXELRXQIT
RIXNVHRLKLGKSIGQEFQMFSFSGIVAATNNFSSXSKLGEGGFGPVYKGVLPDGQQVAV
KRLARNSGQGLEEXRNEITLIAELQHRNLVRILGCCIQGEEKILIYEYLTNASLDAFLFD
STKGKHLDWQQRVNIIEGIAQGLLYLHKYSRVRIIHRDLKASNXLLDGNXNPKISDFGMA
RIFEXNESTSKTKRVVGTYGYMSPEYAMKGIFSDKSDVYSFGVLLLEIVSGKKNTEFVSS
TALSLVELXWDLWKQGXTQELKDTSVDSCPEDEVLKFIHLSLLCVQEYAADRPTMAEVVS
MLXSDSMFFPDPKQPAYHISRSEVGSSRPDGRRXDMGSADYVPITVMEAR
Download sequence
Identical sequences MDP0000137471 MDP0000137471|PACid:22680253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]