SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000138851 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000138851
Domain Number 1 Region: 8-209
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.37e-40
Family FAD/NAD-linked reductases, N-terminal and central domains 0.014
Further Details:      
 
Domain Number 2 Region: 174-232,274-341
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000171
Family FAD/NAD-linked reductases, N-terminal and central domains 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000138851
Sequence length 382
Sequence
MQEHNKVVIIVGAGTSGLAMAGCLSRLAIPYIILEREDCFASLWTKYSYDRLHLHLRKQF
CELPHMSFPTSYPTYVPKNQFIRYLEDYVSHFSIRPMYKRNVESAQYDQVSKKWIVKAKN
VGGSGEMEEYFGGFLVLATGETTDPYIPEIEGLSSFNGDVLHSTKYKSGKEFENKKVLVV
GAGNSGMEISLDLANHGAKTSIIVRSPVHFLSRGMLYFFVLLKLFPSSMVDSLLVLLSKL
VFGNLASYGIERPQKGPIYMKAKYGKYPIIDVGTCRKIKSGEIQVLPAEIGSIRGGQVEL
KNGKSYQFDAIIFCTGFKSSTNLWIKGDDYLLKDDGIPKPSSPDLWEWKGKNGLYCVGLS
GRGFNGSKMDAQNIANDIKSFL
Download sequence
Identical sequences XP_008368915.1.92800 MDP0000138851 MDP0000138851|PACid:22674897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]