SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000141032 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000141032
Domain Number 1 Region: 115-205
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.22e-21
Family alpha-D-mannose-specific plant lectins 0.0049
Further Details:      
 
Domain Number 2 Region: 312-365
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000081
Family Protein kinases, catalytic subunit 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000141032
Sequence length 487
Sequence
MDSVHALHTSSSAPQLQRRKLFGCLHLGINAWESSSVVAMINLDCKMESSSVRVLEQTFE
ECGEYFASILGNQVLGKVKEXDAGHGGVVAVEVENEIVDDTCFFSLXGNPMNRHLGIWYI
NIPSKVLWTATRNSPLTDLYGKLAIGTNGNLVLLNRNAXXIWSSNVSXTPKTRVTQLLDS
GNLVLKENTSSAGTYVWQSFDNPFDTLLLKIGIPYVSQGFTPRFXEEWELSNGTSGCMRW
TPLDCHSGEGCLLLVGVKLPDMLEFSLNECMNLKECRALFTRLQFVMYSKQEGVCFDVHL
IITKMHVQYDQIQGSFSGQEIXVKRVSHPCQGLEEFXNVVVLIAKLQHRNLVSLLGCCIH
GDEYVFGFGVLLLEIGNXNRRFSHLDHNHNLVGHXWLLWNEXKSLEILHKYLEESCIESQ
GARLPWPEQPGFFMERCSTDLDTRTRGEQSHTQNEISPTVEGSMPLCQLEEKTKDDPIVL
HGVPNII
Download sequence
Identical sequences MDP0000141032 MDP0000141032|PACid:22674007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]