SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000143712 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000143712
Domain Number 1 Region: 19-114
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.27e-18
Family alpha-D-mannose-specific plant lectins 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000143712
Sequence length 211
Sequence
MVFSSWGCSSREGFRCGTWEYANRDALHWNSSKATLKIGDHGNLALVDGETGKMTWSSNE
TQATNLIFKLLDPDNLVLREXNSYHDEFLWQSFDYPTNTLLLDMKLGWILNTGLDRELQH
FKPKDQCDSFKECGLDRICDSNASPVCKCLKGFEPKNLQAWSLRDGADRCVRKAKLNYAN
DKVFSLENIKLLDSGEAFVNLNMSLEACKKM
Download sequence
Identical sequences MDP0000143712 MDP0000143712|PACid:22644736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]