SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000146158 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000146158
Domain Number 1 Region: 282-451
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.47e-21
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0063
Further Details:      
 
Domain Number 2 Region: 111-291,377-451
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.9e-18
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000146158
Sequence length 549
Sequence
MAFERISRTARHGFRRSPSGASSRTTEKDMLCERASTXKYCSVPSLEREXRNNNLSYLSS
ISKVNHNSFWSRGISITPXYQFPSAERIVEESDSECNDPKYPGLEATRPSEKPRVVVLGT
GWAACRFLKGLDTKVYDVVCISPRNHMVFTPLLASTCVGTLEFRSVAEPVSRIQSALAAS
PSSYFYMASCVGLDTDKHEVYCETISNGGLSHEPYRFKVAYDKLXIAAGAEPLTFGIKGV
KEHAFFLREVNHAQEIRKKLLLNLMLSEHPGISEEERKRVLHCVVIGGGPTGVEFSGELS
DFIMKDVQERFSHVKDYIKVTLIEANEILSSFDXGLRQYATNHLTXVGVRLMRGVVKEVH
PKKIVLNDGTDVPYGLLVWSTGVGPSEFVKKLXLPKSPGGRIGVDGWMRVPSVEDVFALG
DCAGFLEETGRPVLPALAQVAEREGKYLVEXFNRIGKQDAGKAFSAKDIPLGEQFVYKHL
GSMATVGGYKALVDLRQSKDAKGISLAGFLSWLIWRSAYLTRVVSWRNRFYVAVNWATTL
VFGRDNSRI
Download sequence
Identical sequences MDP0000146158|PACid:22623090 MDP0000146158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]