SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000147542 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000147542
Domain Number 1 Region: 151-215
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.00000000000000266
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.0075
Further Details:      
 
Domain Number 2 Region: 311-363
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000389
Family FAD-linked reductases, N-terminal domain 0.023
Further Details:      
 
Domain Number 3 Region: 309-377,426-493,588-648
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000763
Family FAD-linked reductases, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000147542
Sequence length 895
Sequence
MAADEMGRQRDGDIGVGGGGTGFPDRSKYPRIIAAQLSGKSSRPGFDGKDSIAYRFSDLK
TDPQGREPWERDGDGGREGGGEVVMEGRVLQKNCFLVLKYCCLSIPLNPGFNVDFELSTS
EKMLEFRTGGSTNHFFTVEVWWSNAIIHAAEKLLVLLRDGRKLLGILRSFDQFANAVLEG
ACERVIVGDLYCDIPLGLYVIRGENVVLIGELDSEREELPPHMTRVSAAEIKRAQKAERE
ASDLKGNIETQSNCFMGPGRVHLQFHHGIENYLTPKYGKNIWFAVKGIGFWDLWEGGGRR
KGGETKKKMFTSVDCVVVGGGISGLCIAQVLATKHGDVVPIVIVTEAKDHVGGNIITVEK
DGYARAETRLRLERKDPTKLSRGFGKDKQAGVYPPALLAFLLCVLSAEASVHKYAAERFA
TKGSAFVIHGGSEGIYSSSPAQSASDSVNGDSFIRFEKVTFRRSRESANLSSWPVHAIVF
EVEDRETIGGSAYGGQRAVCCSGDLAKLGVCAQGEIIHRQSTENPGWPQVFGVSFEEHEE
VATLPSKSIPITKTGMYNLYFIHCDLSIKDVVVEGKTIWKNPTGYLPGRMAPFMNFYGFM
SFAFVILGIGWFSQYARFWREVFPLQNCITLVITLGMLEMALWYFEYAEFNETGVRPTGI
TVWAVTFGTVKRTVARVILLMVSMGYGVVRPSLGGLTSKVILLGLTFFLASEVLEMVENV
GAVSDLSGKARLFLVLPVAVLDAFFILWIFTSLSATLKKLQARRMMVKLDIYRKFTNALA
VTVIVSVGWICYELYFKSNDVYNEQWQNAWIVPAFWQVLSFSLLCVICILWTPSQTSTRY
AYSGDSEEFDKDDTTLTLIKPALTPAKDAGSALETRPVKGSNGASNGNDEEDKIE
Download sequence
Identical sequences MDP0000147542 MDP0000147542|PACid:22652542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]