SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000149067 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000149067
Domain Number 1 Region: 202-234
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000864
Family FAD/NAD-linked reductases, N-terminal and central domains 0.034
Further Details:      
 
Weak hits

Sequence:  MDP0000149067
Domain Number - Region: 13-48
Classification Level Classification E-value
Superfamily At5g01610-like 0.000111
Family At5g01610-like 0.017
Further Details:      
 
Domain Number - Region: 73-103
Classification Level Classification E-value
Superfamily TPR-like 0.00552
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000149067
Sequence length 289
Sequence
MSSIITAEIKSKADELYHGDEICKQKSKEFLSEICLPNGLLPLKDIEELLNFSLENPQGL
SSESESGRETAEILDQYNNAVLAYKKGLEIDPNNKARKSGLVNTQAGAARSRAGPSPMNP
DAEAFSGLEMWAKLTADPLTRAFLQQPHKARSFLQWRPAKALIVLLFLTVIPLTNNNQQP
KNASFSRSSTISASSSSGNGSPPKSFDYDLLIIGAGVGGHGAALHVVKKVLKTAIMRRLE
RDLKKAGKGDWIGISINLVPTTVGKHGNHDCGSGQRSSTIPLKKRKPTG
Download sequence
Identical sequences MDP0000149067 MDP0000149067|PACid:22669209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]