SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000151152 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000151152
Domain Number 1 Region: 492-781
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-81
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 83-192
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.83e-24
Family alpha-D-mannose-specific plant lectins 0.0027
Further Details:      
 
Weak hits

Sequence:  MDP0000151152
Domain Number - Region: 369-426
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0392
Family Anti-platelet protein 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000151152
Sequence length 826
Sequence
MGFGNETIGSIFGSTMFFLIFFSLLLSQHNCAEVYKITPSQPFSQTQILVSPSRIFXLGF
FSPNGSVNKYVGIWHMNISPRKVVWVANRENPIAASDTFANLTISSYGNLELVDGKQNSL
WSTNISVPSNGSAAELLDSGNFVIKDDDVGADPLWQSFDYPSDTLLPTMQLGFDSKSGKX
SFLKAWKSESDPSAGWFSVGLSRXVPSQLFVWINESKPYLRSGAWDKSMFIGVPDMDSQY
LSGFTLNDDVNQGTKYFSYRFFDXTLSYIGISSDGVLSLKLSNNGSNWWLSWEALVNPCE
IYGTCGVNGVCKGSESPXPNCECLKGFVPKSNEEWSKGNWTGGCVRHTELFCEQSNTSRS
FXSGGKEDVFWKMVGLRLPDFHELIEKLGXEECKIRCLNNCSCQAYAQVNNIGCLVWSSD
LIDIQEFSSGGNDLYIRLAHGALDEGKPVKLIASVTAVGFITILSAIAFGVHRLRSRITG
DNLQEYIRKHDPSELFIYDFDSILTATNNFSTTNKLGEGGFGPVYKGKLQEGREIAVKRL
SSSSGQGMEEFKNEMLLISKLQHKNLVRIMGCCVKDDEKLLIYEFMPNRSLDTLLFDPKR
REELDWATRFNIIQGVARGLLYLHHDSRLKVIHRDLKVSNILLDENMNPKISDFGLARIV
EATQSLANTHKVVGTRGYMSPEYAMGGIFSEKSDVYSFGVLLLEIIANKKNNSFYCNEEQ
HGFLAHVWHLWXEGRGLDLLDEVLVDSYSSLEVMRCMHIGLLCVQDKSEDRPTMPDVVFA
LSSETDLPLPKQPIFSYFRISVSNPQPKYDNILSANEDAITVIEGR
Download sequence
Identical sequences MDP0000151152|PACid:22639387 MDP0000151152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]