SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000157193 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000157193
Domain Number 1 Region: 83-209
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.84e-23
Family alpha-D-mannose-specific plant lectins 0.0036
Further Details:      
 
Domain Number 2 Region: 174-274
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000327
Family alpha-D-mannose-specific plant lectins 0.0051
Further Details:      
 
Weak hits

Sequence:  MDP0000157193
Domain Number - Region: 337-384
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00153
Family Anti-platelet protein 0.072
Further Details:      
 
Domain Number - Region: 280-317
Classification Level Classification E-value
Superfamily Ganglioside M2 (gm2) activator 0.0915
Family Ganglioside M2 (gm2) activator 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000157193
Sequence length 389
Sequence
MPELVEHFRKSRLLLCIFVAFLLNTLATSDIPLGSKISVADKNIWISPNGDFAFGFFNRS
DQPNYSLGIRLISKSFPLDQQLLVWSAATDLIIGNNSYAQLTQDGELVLFDSLKGVTAWT
SKTRQLSVVSAALNDNGNLVLLNQEKHIVWQSFDTPSDILLPGQSFSTLQTLRAASKNCV
SSYYTLFMSASXQLQLQWESHVTYWRSGSLSSSNLSAFITSDGALQLRDQSLKPVWSLYS
QDHNDSISYRFLXLDVDGNLRLYSWVEDSKSWRSVWQAVENQCDVFATCGQRGICVFNES
GSPDCECPFKQQTNESTSRCFIPNNRCSFGSNMLHYKHTFLHGMYPPTDDVVAKVSLEEC
KSXCQNDLXCTAATFSNDGTARCLIKRTP
Download sequence
Identical sequences MDP0000157193 MDP0000157193|PACid:22621584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]