SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000172516 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000172516
Domain Number 1 Region: 508-789
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.96e-74
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 81-211
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.66e-25
Family alpha-D-mannose-specific plant lectins 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000172516
Sequence length 794
Sequence
MASTFLCIVLLFLAQSSPLASSASNNLKPGSSLSVENSADKLISTNGMFSAGFFPVGENA
YCFGIWFTEPAAADAATQNLTVVWTANRDQLXNGRGSKFTLQKNGNLILTDAGKYTIWSS
NTVFSNSLAQLILXDNGNLVLLTLKGVALWESFASPTDTLLPQQQLTRNTKLVSSRSLTN
CSSGFYSLFFDNDNTLRLLYDGPEVSSIYWHDPWLLSLQAGRTTYNNSRVAVLDALGNFS
ASDGLNFMSSDYGVKLQRRVKADVDGNLRLYSRKSPGDRWVVSWQAIAEPCKIHGICGPN
GLCTYEPSSGRKCSCLPGYEMRNKNDWAYGCQPTTEGFNVSCKSSTARDQFDFMYLPRVE
YFGYDYFIYVNTSLEKCKAICLXLCNCPGFHYKFGGGHHNCYPKTQFRNGYRTPGFTGEL
YLKLPKSILSXYNATAKGFNMCSSKLTSQLSRTYEKKSTNGSVNFMLKFASALGGLELIC
IIVVWYFVMRSSEEKEESDVVTQGYLHAVTGFRRFSYSELKKATRGFKEEIGRGGGGIVY
KGTLSDQRVAAIKQLNAATQGEAEFLAEVSLIGKLYHMNLIEMWGYCVEGKHRLLVYEYM
KNGSLAEKLSSNVLDWNQKFEIAVGTAKGLAYLHEECLEWVLHCDVKPQNILLDSNYNPK
VADFGLSKLLNRSEVSNSKFSRIRGTRGYMAPEWIQNMPITSKVDVYSYGIVVLEMVTGK
SPAEGVQSSEGGGETQKKMMVSRVRENMNGGFENTESKKGEGLMKVALRCSEEDRDARPT
MTQVVEMLLQYQDD
Download sequence
Identical sequences MDP0000172516|PACid:22679032 XP_008367656.1.92800 MDP0000172516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]