SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000189901 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000189901
Domain Number 1 Region: 476-758
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.42e-76
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 65-207
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.95e-18
Family alpha-D-mannose-specific plant lectins 0.008
Further Details:      
 
Domain Number 3 Region: 169-262
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000011
Family alpha-D-mannose-specific plant lectins 0.0094
Further Details:      
 
Weak hits

Sequence:  MDP0000189901
Domain Number - Region: 280-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0153
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000189901
Sequence length 776
Sequence
MLIRSYSMPFTVGFVLAMAFVVAQAQRMQSNISRGSSLTPTTNSSWLSRSGVYAFGFYKQ
GNGYAVGIFLAGIPQTTIVWTAKRDDPPLSSNVTLNFTSDGFGLISTQGQSFVIEYTSAS
SASMLDSGNFVIYNARQDIVWQSFEHPTDTLLPGQSLFAGDXLFSAKSESDHSTGIFRLK
MQADGXLVQYPVNTPDTAPYAYYSSRTYGRKNVTLNFGADGHLYLLNDTGSNIRNITDGG
LPADQATIYLMRIDADGIFRLYSHDLNHNGSKSIVWESSKDKCDPKGVCGLNSYCVSMDL
DAKCKCLPGFVFANLGNKTSSCRRIVADVCEYKNETFPYTMEELQSTIWEDSSYVDLPLS
DKEACKGACLEDCNCEAAIFNGTSCRKQRLPLRYGRREVSTPNLELIKVATSXTAPDTEK
RSKRKGRTDILIISISLAAFGSILFAISVVVLCKHNVWSYGRVNIPILDSELNEDIALRP
YTYEELEKITNNFGEEIGRGASGTVYKGVILASQKRVAVKRLQKVTAEGEKEFQTELKVI
GKTHHKNLVRLLGYCLDGPKRLLVYEYMSNGSLADVLFAPDRQPCWEERMRIARNIARGF
LYLHEECDTQIIHCDIKPQNILMDEYMCPKIADFGLAKLLKADQTRTTTGIRGTKGYVAP
EWHRKMPITVKADVYSFGVVLLEIICCRRNVDWSLPEEEAILDELAYPCFESGEHGKLVG
EQEVDTRQFERMIKVALWCIQDEPSLRPCMKKVLLMLEGTVEIPIPPSPNSILSTI
Download sequence
Identical sequences MDP0000189901|PACid:22644597 XP_008338991.1.92800 MDP0000189901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]