SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000193915 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000193915
Domain Number 1 Region: 483-770
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-81
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 71-179
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.83e-27
Family alpha-D-mannose-specific plant lectins 0.0042
Further Details:      
 
Weak hits

Sequence:  MDP0000193915
Domain Number - Region: 340-409
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0114
Family Anti-platelet protein 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000193915
Sequence length 816
Sequence
MCLLLFYSSLLLIFAAVFSIADDATSTFQSIRDGETVVSTGGTFELGFYSPDASNRRYVG
IWYKKISVTTIVWVANRDTPLTDLSGVLKVTNPGILVLNHNMSTVWSSNTSKTAQNPVAR
LLDSGNLVVIDRSDDDSENFLWQSFDYPGDTFLPGMKLGRNTVTGFNWHLRSWKSPQDPS
QGNCTNQLGPKGYAELFLREGSVIKFRSGPWNGVWFCGNPQLNPNPIYTYSFVSEPDEMY
YSYKLHNSSIFSRLMLTSHGLLQRYTWIDRTKGWVLYQTVQIDNCDNYALCGVHGACNIE
KSPVCSCLKGFTPKFPKEWDLVDWSNGCVRKTSLNCTGDVFQKYSGLKLPSTEQSWFNRS
TNLKECEMVCMKNCSCTAYTNLDIRDGGTGCLLWYGDLIDIRYIAENGQDIYIRMAAAEQ
DYEDDTKINAKYSESNAKKMRIIISTTVLSIGLLILGLALLFYVWKKQHQKGGKLGRNQK
EDLELPLFDLMTIVSATSNFSIENKLGEGGFGSVFKGTMEDGQEIAVKRLSKSSRQGLDE
FKNEVTHIAKLQHRNLVKLLGCCIQEDEMILIYEFMPNKSLDFFIFDQRRRMLLDWSKRF
EIINGIARGLLYLHQDSTLRVIHRDLKASNILLGSEFNPKISDFGLARSFGGNETKAKTK
KVVGTYGYMSPEYAIDGFYSIKSDVYSFGVLVLEIVSGSRNRGFSHPDHKLNLLGHAWML
YTEGMPLKLLDASVEDSVTLHEVVRTIHVGLLCVQRNPEDRPSMSAVVLMLGGGGVLPPP
LKPGFYSERDLTELEVGHSSKACSVNEVTISLVEAR
Download sequence
Identical sequences MDP0000193915 MDP0000193915|PACid:22682408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]