SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000203964 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000203964
Domain Number 1 Region: 371-599
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.51e-40
Family Protein kinases, catalytic subunit 0.0011
Further Details:      
 
Domain Number 2 Region: 59-97
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000187
Family alpha-D-mannose-specific plant lectins 0.046
Further Details:      
 
Weak hits

Sequence:  MDP0000203964
Domain Number - Region: 282-326
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000271
Family Anti-platelet protein 0.093
Further Details:      
 
Domain Number - Region: 73-155
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0245
Family alpha-D-mannose-specific plant lectins 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000203964
Sequence length 640
Sequence
MGGLCFSFMISANLFFLSSTISLAVDGITPSQSVLDGTTLVSSDGSFELGFFSPGSSKNR
YLGIWFKNVPVRTVVWVANRCNPINDSSGVLMINSTGMKXGWDLRTGLKRHLSAWKNSXD
PCPGDFTYGIEMQLQAYPEAYILNGXTKFFRTSAWNELTICGSPEHPSPRYSFNFVYNXD
EVXVTYKPKIESILSRVXLNQTTSTCARFQWKVGXQXWQDFSSRPTESCDYYGFCGANGN
CTSEDPVCKCIQGFSPKSQEKWNLADWSLGCVRNKPLSCHEGDKDEFLKFDGFKLPDTTN
SWVDKSMNLKECRDKCLKNCSCTAYTSSDIGGGSGGCTIWFGDLIDIKQAIANRNPVTEI
RERNEDNEGAPRGDMELPLFDLMTVASATDXFSSNKKLGEGGFGPVYKGTLANGQEIAVK
RLSRSSSQGLNEFMNEVILIAKLQHRNLAIKQFVLKIEVEFGFNLPXETRRELFDWPKRF
NIICGIARDFGLARLLTEGDQTVANTDRVXGTYGYMAPEYVMDGQFSVKSDVFSFGXLVL
ELWRLWNEGKPLELIDTCLGSSGTISEVLRCINIGLLCAQHHPDDRPSMADVVIMLGSQT
ALARPKQPGFFIERGTPEGGSNSGNQSRSTNELSISLLEA
Download sequence
Identical sequences MDP0000203964 MDP0000203964|PACid:22681688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]