SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000204617 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000204617
Domain Number 1 Region: 564-826
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.15e-63
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 148-257
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-28
Family alpha-D-mannose-specific plant lectins 0.0042
Further Details:      
 
Weak hits

Sequence:  MDP0000204617
Domain Number - Region: 418-462
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0011
Family Anti-platelet protein 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000204617
Sequence length 867
Sequence
MTSAEKDERNVNSGFEFLLLRICGLLILFRCSSRTKAATAEGRILVLSPCSAXASPVNET
ARVVKEREHKNKYFMGGLCFSFMISANLFFLSSTISLAVDGITPSQSVLDGTTLVSSDGS
FELGFFSPGSSKNRYLGIWFKNVPVRTVVWVANRCNPINDSSGVLMINSTGNLVLLSQNS
SVVWSTSLVKQAQNATVELLDSGNLVLRDAKXGNSGTPLWQSFDYPSDTLLPGMKLGWDL
RTGLKRHLSAWKNSXDPCPGDFTYGIEMQLQAYPEAYILNGXTKFFRTSAWNELTICGSP
EHPSPRYSFNFVYNXDEVXVTYKPKIESILSRVVLNQTTSTCARFQWKVGYQAWQDFSSR
PTESCDYYGFCGANGNCTSEDPVCKCIQGFSPKSQEKWNLADWSLGCVRNKPLSCHEGDK
DEFLKFDGFKLPDTTNSWVDKSMNLKECRDKCLKNCSCTAXTSSDIGGGSGGCTIWFGDL
IDIKQVPVAGKEIYIRTSAAEIVNNEGENSTKVKIAIIVVGIAIVFSGVLLVGYVIRRRK
RKNKANRNPVTEIRERNEDNEGAPRGDMELPLFDLMTVAXATDXFSSNKKLGEGGFGPVY
KGTLANGQEIAVKRLSRSSSQGLNEFMNEVILIAKLQHRNLAIKQFVLKIEVEFGFNLPN
ETRRELFDWPKRFNIICGIARGLVYLHQHSRLRIIHRDLKASNVLLDNELNPKISDFGLA
RLLTEGDQTVANTDRVIGTYGYMAPEYVMDGQFSVKSDVFSFGVLVLELWRLWNEGKPLE
LIDTCLGSSGTISEVLRCINIGLLCAQHHPDDRPSMADVVIMLGSQTALARPKQPGFFIE
RGTPEGGSNSGNQSRSTNELSISLLEA
Download sequence
Identical sequences MDP0000204617 MDP0000204617|PACid:22666795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]