SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000213104 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000213104
Domain Number 1 Region: 74-184
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.1e-26
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Weak hits

Sequence:  MDP0000213104
Domain Number - Region: 345-407
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00863
Family Pan module (APPLE domain) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000213104
Sequence length 494
Sequence
MQALTSFFTCLFFLFSLLRISAATARGTITPSRYIRDGETLVSVGGSYEMGFFSPGKSKS
RYVGIWYTDSTDAVVWVANRETPLGDSSGLLMLTEQGVLVLLVNSSNKIVWSSNSSRIAG
NPVSQLLDSGNLVVQDGNETNPDNFLWQSFDYPCDTYLPEMKLGWDLVTGLERYLSSWKS
TEDPAPGEFSARIDYRGLPQLFVMKRAKKVGRGGSWNGLHLTGFSSGQPNPISRIEFVWN
KDEVYCQFRLLNRSVFQRLVLSPLGVSLLFTWEYQTHSWEFASTLQEDRCESYALCGAYT
ICKINNSPICVCLKGFVPKSPQDWNSGNWSDGCVRMTPLACSHGDGFLTYSGVKLPDTSS
SWYDKSMSLEQCKGLCLGNCSCTAYTNLDVREGGTGCLLWXDNXIDIREFTLGQDLYIRM
AASELDHVKKKSNFNKRQLLAILLSSAVFLMGMLIVGIILYIRKXKLXNEGLRTKDCGEE
YPGRRRGRHGVTTV
Download sequence
Identical sequences MDP0000213104 MDP0000213104|PACid:22679458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]