SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000213485 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000213485
Domain Number 1 Region: 68-134
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 3.5e-21
Family Protein serine/threonine phosphatase 0.00013
Further Details:      
 
Domain Number 2 Region: 211-303
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000000641
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000213485
Sequence length 511
Sequence
MAMFCGTPAYTLLHVIRPKKLLIESANEQENGNLLLKVHAFKGALREDQGNINGRKQCPG
FGPIMIWTCLEPVKSPVTICGDIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVE
TVTTISFLDRVRCLLPIISSVTHWRTICLPMCPIIQQYCSKNDKKMRNHTSVFSIADDGT
STFQSISDGETVVSTGGTFELGFYSPDASNRRDTPLTDLFGVLKITNPGILVLNHNMSTI
WSSNTSRTAQNPVAHRSDDDPENFLWXSFDYPGDTCLPGAKLGRNTVTGFNWHLRSWKSP
QDPSPGYAEMFLREGSVIKFRSGPWNGVRFSGMPQLSPNPIYTYGLVFETDEMYYSYKLR
NNSILSNMVLTSEGLSRRYIWIDRTKDWFLYLTAQIDNCNNYAFCGVYGTCNIEKSPVCS
CLKGFTPKFPNEWDLVDWSNGCVRKTSLNCTGDVFQKYSGLKLPSTEQSWFNRSMNLKEC
EMVCMKNCSCTAYTNLDIRDGGSGCLLCRRF
Download sequence
Identical sequences MDP0000213485 MDP0000213485|PACid:22632496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]