SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000219560 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000219560
Domain Number 1 Region: 1-187
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000906
Family FAD-linked reductases, N-terminal domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000219560
Sequence length 188
Sequence
MGATWIHGIGGSPVHKIAQEINPRVSASVGVHGRVLRRAHHRREMWVGAGTGCGGPHFVS
VQELDGLCSGEAESEYRMFPGEEIIIAKGYLSIVQSLASVLPPGLIQLGKKVRKIQWQPD
NRKNKGYESDTRLVKLHFSDGSVLLADHVIVTVSLGVLKASICQDSGMFNPPLPRFNTEA
IPRLGFGL
Download sequence
Identical sequences MDP0000219560 MDP0000219560|PACid:22625984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]