SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000253362 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000253362
Domain Number 1 Region: 67-186,221-339
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.81e-36
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.079
Further Details:      
 
Domain Number 2 Region: 315-407
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000104
Family D-aminoacid oxidase-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000253362
Sequence length 660
Sequence
MATATRLRRLGAAACVATAASGAFLLQPSFSANDRGNGPSSLGAVRQRISDPNAVVPSRA
AQEAALISASASNPLDILVIGGGATGSGVALDAVTRGLRVGLVEREDFSSGTSSRSTKLI
HGGVRYLEKAVFNLDYGQLKLVFHALEERKQVIENAPHLCHALPCMTPCFDWFEVVYYWM
GLKMYDLVAGLRLLHVSRYYSAQESVELFPTLARKGNNKSLKGTVVYYDGQMNDARLNVG
LACTAAVAGAAVLNHAEVVALLKDEASNRTIGARIRDNLSGKEFDIYAKVVVNAAGPFCD
SLRKMADQDAKPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTIAGTT
DSNTSITLLPEPHEDEIQFILDAICDYLNVKVRRTDVLSAWSGIRPLATDPSAKSTESIS
RDHVVCEDYPGLVTITGGKWTTYRGMAEDAVNAAIKSGNLTPENGCLTSKLQIVGGDGWD
PASFTVIAQQYVRMKNSHGKVVPAVMDTAAARHLSHAYGTFAERVAAIAQNENLGKRLAH
GYPFLEAEVAYCARNEYCESAIDFIARRSRLAFLDTDAASKALPRVIEILATEHKWDNSR
QKYELEKAKEFLETFKSSKNAQFHDGKHVYVLNGGKFSGLNSGAKEYACHAQHKGIVTXQ
Download sequence
Identical sequences MDP0000253362|PACid:22653297 MDP0000253362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]