SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000260827 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000260827
Domain Number 1 Region: 61-233,327-437
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.37e-48
Family FAD/NAD-linked reductases, N-terminal and central domains 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000260827
Sequence length 538
Sequence
MADQYLLGWIFATVLGVVFLYRALAKRSDEKGRGLVEEENRSECVKSVMVSNGECRSTDG
DVDVIIVGAGVAGAALAHTLGKDGRRVHVIERDLTEPDRIVGELLQPGGYLKLIELGLED
CVEQIDAQRVFGYALFKDGKNTRLSYPLEKFHSDVSGRSFHNGRFIQRMREKAATLPNVR
LEQGTVTSLLEEKGTIKGVQYKTKTGEEMTAYAPLTVVCDGCFSNLRRTLCDPKVDVPSC
FVGLVLENCNLPHANHGHVILADPSPILFYKISSTEVRCLVDVPGQKVPSISNGEMAKYL
KTXVAPQIPPQIYDSFVAAVDKGTIRTMPNRSMPAAPYPTPGALLMGDAFNMRHPLTGGG
MTVALSDIVVLRNLLKPLGNLNDPSTLSKYLESFYTLRKPVASTINTLAGALYKVFSSSP
DQARKEMRQACFDYLSLGGVFSTGPVSLLSGLXPRPLSLVLHFFAVAVYGVGRLLLPFPS
PKRAWIGARLISSASGIIFPIIKAEGVRQMFFPATVPAYYRAPVSSEKQLKKTEGCVX
Download sequence
Identical sequences MDP0000260827 XP_008393683.1.92800 MDP0000260827|PACid:22621315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]