SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000261851 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000261851
Domain Number 1 Region: 577-869
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.29e-80
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 165-273
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.27e-26
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Weak hits

Sequence:  MDP0000261851
Domain Number - Region: 434-499
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0432
Family Pan module (APPLE domain) 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000261851
Sequence length 910
Sequence
MPSMPAAVLMLSGESALPELEKPGFYSERDLDDNKVDPCANKTTFSVSXFGEQFVFPRTR
XFNNXELENDWLLAXNDKHSNHIXKNPSKASAKMCLLLFYSSLLLIVAAVFSTADDATST
FQSIRDGETVVSTGGTFELGFYKYPDAXNXRYVAIWYKQISVTTIVWXANRDKPLADLSG
VLKVTXPGILVLNHNMSTVWSSNTSRTAQNPVARLLDSGNLVVIDSSDDDSENFLWQSFD
YPGDTFLPGMEIGRNTVTGFNCHLRSWKSPQDPSQGNYTYQLGPKGYQEIFVSNGSVIKF
RTGPWNGVRFSGTPHLNPNPIYTYGFVSEPDKMYYSYKLHNSSIFSRVVLTSDGLVQRYT
WIDRTKDWFLYLTAQIDNCDNYAFCGVYGACNIEKSPVCSCLKGFTPKFPKEWDLVDWSD
GCVRKTSLNCTGDVFQKYSGLKLPSTEQSWFNRSMNLKECQMVCMKNCSCTAYTNLDIRD
GGTGCLLWYGGLIDIRYYSENGQDIYIRMAAAEQDYEDDAKINAKYSESNAKKMKIIIST
TVLSTGLLLLGLALLFFVWKKQHQKVGKLGHNQKEDLELPLFDLMTIVSATGNFSIENKL
GEGGFGSVFKGTMEDGQEIAVKRLSKSSRQGLDEFKNEVTHIAKLQHRNLVKLLGCCIQE
DEMILIYEFMPNKSLDFFIFDQRRRMLLDWPKRFEIINGIARGLLYLHQDSRLRVIHRDL
KASNILLGREFNPKISDFGLARSFGGNETKAETKKVVGTYGYMSPEYAIDGFYSIKSDVY
SFGVLVLEIVSGSXNRGFSHPDHKLNLLGHAWMLHTEGRPLELLDTSVEDSITLFEVVRT
IHVGLLCVQRNPEDRPSMSAAVLMLSGEGALPQPLKPGFYSERDLTELEASHSSKACSAN
EVTISVLEAR
Download sequence
Identical sequences MDP0000261851|PACid:22680921 MDP0000261851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]