SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000262982 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000262982
Domain Number 1 Region: 25-226
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.18e-45
Family FAD/NAD-linked reductases, N-terminal and central domains 0.035
Further Details:      
 
Domain Number 2 Region: 190-238,286-403
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000149
Family FAD/NAD-linked reductases, N-terminal and central domains 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000262982
Sequence length 484
Sequence
MENLFRLADXEDFFARRCIMVNGPIIVGAGPSGLATAACLRDQGVPFVVFERAECIASLW
QKRTYDRLKLHLPKAFCQLPKFPFPEDFPEYPTKRQFIDYLESYAKHFEINPKFNXCVQS
ARYDETSGFWRVKXVTSTESTRSEVEYICRWLIVATGENAECVVPEINGLSEFGAEVMHA
CEYKSGENFRGKKVLVVGCGNSGMEVSLDLCNHNAFPSMVVRSSVHVMPREIFGKSTFEL
AVFLLKWLPVWLADKLLLMXSWLVLGSIEKYGLKRPSMGPMEMKNVEGKTPVLXIGALDK
IKSGGIKVVPGIKRFXPXQVELVNGETLEIDSVVLATGYRSNVPSWLQEGDFFSKNGFPK
QPFPHGWKGNAGLYAVGFTRRGLSGASNDAMRIAQDIGNVWKGETKQTFSTSNXKNNTWG
WPRFFSATITSNFSSAYYCTSEELDFVPSHVVSPAQPGVSGPIWIVRRILDLKVKEMQQF
ILGQ
Download sequence
Identical sequences MDP0000262982 MDP0000262982|PACid:22620906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]